Menu
Top AOD 9604 peptide powder 2mg per vial CAS 221231-10-3

Top AOD 9604 peptide powder 2mg per vial CAS 221231-10-3

Jul 28, 2022
Hong Kong
AOD9604 is a modified version of the hGH fragment 176-191 peptide (contains a di-sulfide bridge) and thus a derivative of human growth hormone (hGH). Originally developed as a lipolytic (fat burning) compound, AOD9604 has shown benefit in studies...
Hong Kong
6YRS
YES Gold
Main Item hgh, jintropin, hygetropin, testosterone enanthate, winstrol dosage, nandrolone decanoate, sustanon 250, masteron, androl 50, mesterolone, TE250, SR9009
Business Type Manufacturer, Exporter, Distributor, Wholesaler/Retailer
99% Human growth hormone HGH fragment 176-191 (frag 176-191) raw powder PEPTIDE CAS 221231-10-3

99% Human growth hormone HGH fragment 176-191 (frag 176-191) raw powder PEPTIDE CAS 221231-10-3

Jul 17, 2024
China
Name: HGH fragment 176-191 CAS No.: 221231-10-3 Other Names: fragment 176-191 Purity: 98.5%min Brand Name: BIG BULL LAB Grade: Pharm Medicine Grade MFG: each batch fresh in 2023 Shelf Life: 2 years of proper storage Appearance: White Powder Test...
China
2YRS
YES Gold
Main Item testosterone, trenbolone, nandrolone, boldenone, steroid powder, anavar, hgh, Human Growth Hormone, HCG, Human Chorionic Gonadotropin, anavar, anadrol
Business Type Manufacturer, Exporter, Agent, Distributor, Wholesaler/Retailer, Service
Peptides powder HGH 176-191 for Fat Loss Growth Hormone peptide fragment 176-191/HGH FRAG paypal Le

Peptides powder HGH 176-191 for Fat Loss Growth Hormone peptide fragment 176-191/HGH FRAG paypal Le

Jan 16, 2024
China
Introduction Fat Loss Growth Hormone Peptides , Peptides HGH Fragment 176-191 Muscle Growth Hormone Peptides Hgh Fragment 176-191 (2mg/vial) For Bodybuilding Supplements Peptides powder HGH 176-191 for Fat Loss Growth Hormone peptide fragment...
China
Main Item hgh, human growth hormone
Business Type Manufacturer
Legal RHGH Human Growth Hormone Peptide With Blue Tops

Legal RHGH Human Growth Hormone Peptide With Blue Tops

Jul 15, 2024
Hong Kong
Legal RHGH Human Growth Hormone Peptide With Blue Tops Supply rHGH raw material freeing dryed white powder Usually the packing is 10iu/bottle, 10 bottle/box, The Moq is one box. Storage temperature: strore in 2~8 °C, confined saving and...
Hong Kong
3YRS
YES Gold
Main Item Steroids tablet, SARMS, steroids injectable oil, peptides, steroids raw powders, pharmaceutical intermediates
Business Type Manufacturer, Exporter, Importer, Service
Supply Testosterone Enanthate/Test E/Test en/ TE /steroid raw powder oil HGH peptides Tesamorelin

Supply Testosterone Enanthate/Test E/Test en/ TE /steroid raw powder oil HGH peptides Tesamorelin

Feb 29, 2024
China
Supply Testosterone Enanthate/Test E/Test en/ TE /steroid raw powder oil HGH peptides Tesamorelin We also supply other peptides, steroids raw powder, injection oil, oral pills. Welcome to send an inquiry to get more information. Quality: Purity...
China
Main Item polypeptide
Business Type Manufacturer, Exporter
5mg 10mg CAS 86168-78-7 Sermorelin Lyophilized Powder for Treat dwarfism

5mg 10mg CAS 86168-78-7 Sermorelin Lyophilized Powder for Treat dwarfism

Jul 18, 2024
China
5mg 10mg CAS 86168-78-7 Sermorelin Lyophilized Powder for Treat dwarfism Product Details Product name Sermorelin color White Product synonyms SERMORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;growth hormone releasing factor*fragment1-29 ami;GROWTH...
China
1YR
YES Gold
Main Item Peptide, Semaglutide, Tirzepatide,
Business Type Manufacturer, Exporter, Wholesaler/Retailer, Others
China Diamond Raw Steroid Powder Roids Muscle Supply Bodybuilding

China Diamond Raw Steroid Powder Roids Muscle Supply Bodybuilding

Jul 18, 2024
China
China Diamond Raw Steroid Powder Roids Muscle Supply Bodybuilding We are best china steroid powder supplier, factory price, top quality, best after-sales service, Professional packing team and safe shipping way. Here is full list for steroid...
China
1YR
YES Gold
Main Item steroid powder, hgh, sarms, peptides
Business Type Manufacturer, Exporter, Wholesaler/Retailer
Green Top HGH 100iu Human Growth Hormone

Green Top HGH 100iu Human Growth Hormone

Jul 16, 2024
China
Green Top HGH 100iu human growth hormone Body Muscle manufacturer with factory located in China. provides u with hgh, Peptide. Steroids prodcuts of all kinds. finished and raw materials.Wholesale Steroids, Testersterone, HGH Raw Material Powders...
China
3YRS
YES Gold
Main Item testosterone, trenbolone, nandrolone, boldenone, steroid powder, anavar, hgh, Human Growth Hormone, HCG, Human Chorionic Gonadotropin, anavar, anadrol
Business Type Manufacturer, Exporter, Agent, Distributor, Wholesaler/Retailer, Service
Lab Tested Injection Finished Peptides Growth Bodybuilding Hormones Cartridges Pens 36iu 50iu Cindy

Lab Tested Injection Finished Peptides Growth Bodybuilding Hormones Cartridges Pens 36iu 50iu Cindy

Jul 1, 2024
China
Contact: teletgram: @cindyc0951 whatsapp: +86-15233112267 We are a professional supplier of peptide steroids raw powder, oil and tablets. We focus on providing customers with high-quality products, competitive prices, best service and timely...
China
Main Item Chemical
Business Type Manufacturer, Exporter, Distributor
GHRP-6 CAS136054-22-3 Wholesale Healthy Human Growth Hormone Peptides 99% Purity White Powder Steroi

GHRP-6 CAS136054-22-3 Wholesale Healthy Human Growth Hormone Peptides 99% Purity White Powder Steroi

Nov 30, 2021
Hong Kong
GHRP-6 CAS136054-22-3 Wholesale Healthy Human Growth Hormone Peptides 99% Purity White Powder Steroid Hormones For Bodybuilding Product Details Main product information: Product Name;GHRP-6 Chemical Name;Growth hormon releasing peptide-6 CAS...
Hong Kong
Main Item steriods raw powders, hgh, peptides
Business Type Manufacturer, Distributor, Wholesaler/Retailer
HGH Raw Material(HGH191aa API)

HGH Raw Material(HGH191aa API)

Apr 19, 2024
China
HGH raw material Product name:Recombinant Human Growth Hormone Characters:A white or almost white lyophilized powder. Identification:Positive PH:6.5-8.5 Assay:As 97.5%of the marked dosage. We can provide various peptide raw materials as well as HCG...
China
Main Item Chemical
Business Type Manufacturer, Exporter
Best Local Anesthetic Cinchocaine Dibucaine Mepivacaine Levobupivacaine hydrochloride HCL Powder

Best Local Anesthetic Cinchocaine Dibucaine Mepivacaine Levobupivacaine hydrochloride HCL Powder

Jul 3, 2022
China
Best Local Anesthetic Cinchocaine Dibucaine Mepivacaine Levobupivacaine hydrochloride HCL Powder Item details: Item Name Specification Product Name Best Local Anesthetic Cinchocaine Dibucaine Mepivacaine Levobupivacaine hydrochloride HCL Powder...
China
Main Item HGH series, sterioids, Anabolics, Beauty products, Bodybuilding and weight loss products.
Business Type Manufacturer, Exporter, Importer, Agent, Distributor, Wholesaler/Retailer, Service
Legal RHGH Human Growth Hormone Peptide With Blue Tops

Legal RHGH Human Growth Hormone Peptide With Blue Tops

Apr 17, 2020
Hong Kong
Legal RHGH Human Growth Hormone Peptide With Blue Tops Supply rHGH raw material freeing dryed white powder Usually the packing is 10iu/bottle, 10 bottle/box, The Moq is one box. Storage temperature: strore in 2~8 °C, confined saving and...
Hong Kong
Main Item steroids, Research Chemicals, Chemical Raw Materials, Medical Raw Materials
Business Type Manufacturer, Wholesaler/Retailer
taitropin 100% top quality hgh

taitropin 100% top quality hgh

Mar 28, 2022
China
Hgh HGH taitropin taitropin 100iu hgh Gh gh hg Hg original human growth hormone hot selling china gear hgh for bodybuilders strong muscles Steroids raw material steroids powders peptides . The hot selling season is coming . Free samples can be...
China
Main Item hgh peptides steroids
Business Type Manufacturer, Exporter, Distributor, Wholesaler/Retailer
Growth Hormone

Growth Hormone

Jan 25, 2015
China
Changchungelusiteheilongjiangfengongsi China Manufacturer with main products: RHGH, Hygetropin HGH, Kigtropin HGH, HGH Blue Top, Taitropin HGH, Steroids, Peptides HGH, HGH Raw Powder 1st Blue tops hgh Human Growth Hormone Blue tops hgh Human Growth...
China
Main Item growth hormone
Business Type Wholesaler/Retailer
Hgh hormone Taitropin 100iu 10iu vial

Hgh hormone Taitropin 100iu 10iu vial

Dec 14, 2015
China
Hgh hormone Taitropin 100iu 10iu vial Hgh hormone Taitropin 100iu 10iu vial Hgh hormone Taitropin 100iu 10iu vial Spec: 10iu*10vials/kit We supply: all kinds of rhgh, steroids, peptides and hormone raw powder For further information please feel...
China
Main Item rhGH, IGF, MGF, MT, CJC, PT141,  and other steroids, peptides and medical instrument
Business Type Manufacturer, Distributor