Menu
Location:

Guangdong, China

Main Item: Peptide, Semaglutide, Tirzepatide,
Business Type: Manufacturer, Exporter, Wholesaler/Retailer, Others
play vidio

5mg 10mg CAS 86168-78-7 Sermorelin Lyophilized Powder for Treat dwarfism Product Details Product name Sermorelin color White Product synonyms SERMORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;growth hormone releasing factor*fragment1-29 ami;GROWTH...

Send your message to this supplier
Niki Song ( Guangdong Yinuo Pharmaceutical Research Co., Ltd )
(20~4000 Characters)
Listed on Jul 18, 2024