Menu
Diamond Raw HGH Human Growth Hormone (rh-GH) Amino Acids 191 100iu 200iu

Diamond Raw HGH Human Growth Hormone (rh-GH) Amino Acids 191 100iu 200iu

Jul 20, 2024
China
Diamond Raw HGH Human Growth Hormone (rh-GH) Amino Acids 191 100iu 200iu We have best quality with factory price, 100% safe promise shipping way. More details please contact with us. Physiological effect: 1. Promotes growth,regulates bone...
China
1YR
YES Gold
Main Item steroid powder, hgh, sarms, peptides
Business Type Manufacturer, Exporter, Wholesaler/Retailer
Human growth hormone HGH hgh 12629-01-5 with high purity 99%

Human growth hormone HGH hgh 12629-01-5 with high purity 99%

Jul 18, 2024
China
Human growth hormone HGH hgh 12629-01-5 with high purity 99% summarize Human Growthhormone (GH) is a single chain, non-glycated, 191 amino acid hydrophilic globulin with a molecular weight of 21700Da and an isoelectric pI of 4.9. The cysteine...
China
1YR
YES Gold
Main Item Semaglutide, Tirzepatide, Retatrutide, research peptides , TB-500, BPC-157, NAD+, MOTS-c
Business Type Manufacturer, Exporter, Wholesaler/Retailer
Authentic Jintropin HGH,Original Jintropin hgh,Genuine Jintropin hgh with Anti-counterfeiting Code

Authentic Jintropin HGH,Original Jintropin hgh,Genuine Jintropin hgh with Anti-counterfeiting Code

Jul 15, 2024
China
Email:fantastic8product(at)gmail.com, Authentic Jintropin HGH,Original Genuine Jintropin Anti-counterfeiting Code free reship policy Jintropin Human Growth Hormone 191 Amino Acids Bodybuilding Protuct Name: Jintropin HGH Other Names:Human Growth...
China
5YRS
YES Gold
Main Item HGH Series, Peptide Hormone, Steroid Injectable, Steroid Oral Tablets, Steroid Powder, Research Chemical
Business Type Manufacturer, Exporter, Wholesaler/Retailer
JINTROPIN GETROPIN Human Growth Hormone Injectable Steroids HGH Fragment 10IU/3.33mg

JINTROPIN GETROPIN Human Growth Hormone Injectable Steroids HGH Fragment 10IU/3.33mg

Jul 15, 2024
Hong Kong
Safety Bodybuilding Human Growth Hormones Polypeptide HGH 10IU/8IU/6IU/4IU/2IU HGH 10IU/3.33mg (In stock) 8IU/2.66mg (need customize) 6IU/2.66mg (need customize) 4IU/1.33mg (In stock) 2IU/0.66mg (In stock) We can customize the recipe and bottle cap...
Hong Kong
3YRS
YES Gold
Main Item Steroids tablet, SARMS, steroids injectable oil, peptides, steroids raw powders, pharmaceutical intermediates
Business Type Manufacturer, Exporter, Importer, Service
Jintropin 100iu HGH 10 Vials10iu Hgh Human Growth Hormone

Jintropin 100iu HGH 10 Vials10iu Hgh Human Growth Hormone

Jul 21, 2024
China
Jintropin 100iu HGH 10 Vials10iu Hgh Human Growth Hormone Product name: Jintropin Assay: 98% Packaging Standard: Jintropin (10 iu / vial; 10 vials / kit) Type: Vitamins, Amino Acids and Coenzymes Grade Standard: Medicine Grade Appearance: White...
China
3YRS
YES Gold
Main Item testosterone, trenbolone, nandrolone, boldenone, steroid powder, anavar, hgh, Human Growth Hormone, HCG, Human Chorionic Gonadotropin, anavar, anadrol
Business Type Manufacturer, Exporter, Agent, Distributor, Wholesaler/Retailer, Service
99% purity HGH Human growth hormone Somatropin raw powder

99% purity HGH Human growth hormone Somatropin raw powder

Jul 21, 2024
China
What Is Human Growth Hormone (HGH)? Human growth hormone (HGH), also called somatotropin, is a hormone that the pituitary gland, which is about the size of a pea and found at the base of your brain, makes and releases. The pituitary gland has two...
China
2YRS
YES Gold
Main Item testosterone, trenbolone, nandrolone, boldenone, steroid powder, anavar, hgh, Human Growth Hormone, HCG, Human Chorionic Gonadotropin, anavar, anadrol
Business Type Manufacturer, Exporter, Agent, Distributor, Wholesaler/Retailer, Service
Haratropin [rdna Origin] Hgh HPLC>99% SDS>99%,Growth Hormone Serum More Than 30

Haratropin [rdna Origin] Hgh HPLC>99% SDS>99%,Growth Hormone Serum More Than 30

Jun 5, 2024
Hong Kong
Skype Me!! My skype:skype-business-1 Email:doctor at hghsupplier.com Origin China Model Number Original hGH Best Serum Brand Name Haratropin Red Top CAS No.
Hong Kong
3YRS
YES Gold
Main Item 99% HGH, HCG, Steroids Raws/Injectable/Orals Tabs, Peptides, Sarms, Fat Loss, Fitness supplyment, Steroid Cycle, Body Building, Testosterone, Trenbolone, Nandrolone
Business Type Manufacturer, Exporter, Importer, Agent, Distributor, Wholesaler/Retailer, Service, Others
Yellow Top Jintropin Yellow Top HGH

Yellow Top Jintropin Yellow Top HGH

Jun 12, 2024
China
Jintropin yellow top 10IU*10vials*1kit 100Iu/kit Prove Safely shipping to every country, prove clear customs. Usually shipping by EMS, 4-8days reach your door. Offer a tracking number once send. Payment accept Western Union, Money Gram, T/T and...
China
3YRS
YES Gold
Main Item steroid powder, finished oils, sarms tablets, peptides, HGH, HCG, MT2, BPC-157, TB500
Business Type Manufacturer, Exporter, Distributor, Wholesaler/Retailer
Kigtropin (HGH)

Kigtropin (HGH)

Sep 28, 2023
China
Kigtropin (HGH) Specification: 10 IU/ vial, 10 vial/kit Gross Weight: 250g/kit Shipping Courier: EMS or DHL(Guaranteed Delivery and 100% Refund) Packing Methods: Carefully Packed by Three Layer of Foil Paper Following are the reported benefits of...
China
7YRS
YES Gold
Main Item HGH , Peptides , Steroids , .....
Business Type Manufacturer, Exporter, Agent, Distributor, Wholesaler/Retailer
taitropin hgh online china suppliers/manufacturers/sellers

taitropin hgh online china suppliers/manufacturers/sellers

Apr 17, 2023
France
Taitropion, IGF1 is a peptide roughly the same structure and size as insulin, or about 70 amino acids long. It belongs to the peptide family of substances identified as growth factors. It is a highly anabolic hormone released in the liver as well...
France
1YR
Main Item Food and Beverages
Business Type Distributor, Wholesaler/Retailer
Recombinant Human Growth Hormones with 191AA,HGH China supplier

Recombinant Human Growth Hormones with 191AA,HGH China supplier

Jul 28, 2022
Hong Kong
Product Information What is Human Growth Hormone? The benefits of HGH? How to Use? Research course COA and HPLC report 1. Product Information Name: HGH; HGH 191aa; r-hGH; Somatropin CAS No.: 12629-01-5 EINECS No.: 235-735-8 Molecular Formula:...
Hong Kong
6YRS
YES Gold
Main Item hgh, jintropin, hygetropin, testosterone enanthate, winstrol dosage, nandrolone decanoate, sustanon 250, masteron, androl 50, mesterolone, TE250, SR9009
Business Type Manufacturer, Exporter, Distributor, Wholesaler/Retailer
High quliaty 99% hgh Growth hormone 191aa gh support specifications customizable

High quliaty 99% hgh Growth hormone 191aa gh support specifications customizable

Apr 1, 2022
China
High quliaty 99% gh Growth hormone 191aa hgh support specifications customizable Hgh Growth hormone Effect: 1. Promotes growth,regulates bone metabolism 2. Regulates substance metabolism 3. Promotes tissue growth 4. GH Promotes protein synthesis 5....
China
3YRS
YES Gold
Main Item HGH, Steroids Oral, Injectable oil, Sarms, Peptides. API raw materials
Business Type Manufacturer, Exporter, Distributor, Wholesaler/Retailer, Others
HCG 5000iu vial HGH somatropin Jintropin 100iu 240IU WhatsApp +86 17798154547

HCG 5000iu vial HGH somatropin Jintropin 100iu 240IU WhatsApp +86 17798154547

Jul 1, 2024
China
Clear Top Yellow Top Blue Top Red Top Gold Top Green Tops Semaglutide Tirzepatide 5mg 10mg Great Reviews HGH 10IU 2IU 4IU 6IU 8IU 12IU 24IU Hormone Injection for Human Growth Body Fitness UK Canada USA Australia Poland Spain Russia Thailand Etc...
China
Main Item Chemical
Business Type Manufacturer, Exporter, Distributor
Buy Erythropoietin 3000iu HGH bulk order

Buy Erythropoietin 3000iu HGH bulk order

Jul 10, 2024
China
Buy Erythropoietin 3000iu HGH bulk order Specification: IGT 100mgc Gross Weight: 250g/kit Following are the reported benefits of use of Erythropoietin HGH: Losing Cellulite and Wrinkles Gaining muscle / losing fat/weight loss Return of sexual...
China
Main Item rhGH, IGF, MGF, MT, CJC, PT141,  and other steroids, peptides and medical instrument
Business Type Manufacturer, Distributor
HGH,Brand Getropin rHGH,Getropin HGH,Getropin,Kigtropin HGH,Jintropin,Igtropin,Hygetropin,Taitropin

HGH,Brand Getropin rHGH,Getropin HGH,Getropin,Kigtropin HGH,Jintropin,Igtropin,Hygetropin,Taitropin

Apr 19, 2024
China
HGH,Brand Getropin rHGH,Getropin HGH,Getropin,Kigtropin HGH,Jintropin,Igtropin,Hygetropin,Taitropin HGH HGH,Brand Getropin rHGH,Getropin HGH,Getropin,Kigtropin HGH,Jintropin,Igtropin,Hygetropin,Taitropin HGH HGH,Brand Getropin rHGH,Getropin...
China
Main Item Chemical
Business Type Manufacturer, Exporter
5mg 10mg CAS 86168-78-7 Sermorelin Lyophilized Powder for Treat dwarfism

5mg 10mg CAS 86168-78-7 Sermorelin Lyophilized Powder for Treat dwarfism

Jul 18, 2024
China
5mg 10mg CAS 86168-78-7 Sermorelin Lyophilized Powder for Treat dwarfism Product Details Product name Sermorelin color White Product synonyms SERMORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;growth hormone releasing factor*fragment1-29 ami;GROWTH...
China
1YR
YES Gold
Main Item Peptide, Semaglutide, Tirzepatide,
Business Type Manufacturer, Exporter, Wholesaler/Retailer, Others
Factory supply HGH 10iu,16iu,36iu,Cartridge Pen,Dual Vial Chamber,two cartridge

Factory supply HGH 10iu,16iu,36iu,Cartridge Pen,Dual Vial Chamber,two cartridge

Feb 29, 2024
China
Factory supply HGH 10iu,16iu,36iu,Cartridge Pen,Dual Vial Chamber,two cartridge We also supply other peptides, steroids raw powder, injection oil, oral pills. Welcome to send an inquiry to get more information. Quality: Purity above 99%, directly...
China
Main Item polypeptide
Business Type Manufacturer, Exporter
Cheap Blue Cap HGH,HGH Human Growth Hormone Blue/Green Cap

Cheap Blue Cap HGH,HGH Human Growth Hormone Blue/Green Cap

Jan 16, 2024
China
HGH-Blue Top Cap are pure and real. Health Care HGH-Blue Top/Cap, Generics, Human Growth Hormone Specifications: 10iu/vial, 10vial/box, no dilution water inside. Minimum order quantity: 10vials/kit
China
Main Item hgh, human growth hormone
Business Type Manufacturer
Factory Wholesale Retatrutide 10mg Fat Burning Passed Third-party Testing By Janoshik and MZ Biolab

Factory Wholesale Retatrutide 10mg Fat Burning Passed Third-party Testing By Janoshik and MZ Biolab

Apr 23, 2024
China
About Retatrutide Retatrutide is referred to as Eli Lilly's triple G or ggg - as it targets 3 receptors: GIP, GLP-1 and glucagon. Triple is is also known as a tri-agonist. Retatrutide is a powerful weight loss therapy that helps people to shed...
China
3YRS
YES Gold
Main Item hgh191aa peptide steroids Growth hormone muscle supplement
Business Type Manufacturer, Exporter, Wholesaler/Retailer
HGH 100iu High purity 98% and 99.7% Blue top HGH

HGH 100iu High purity 98% and 99.7% Blue top HGH

Jan 8, 2024
China
Hot product in stock: Riptropin 10iu/vial,10vial/kit Blue/yellow/red/green/black/white top hgh 10 IU/ vial, 10 vial/kit Kigtropin HGH 10 IU/ vial, 10 vial/kit Taitropin HGH 10 IU/ vial, 10 vial/kit Getropin HGH 10IU/vial,10vial/kit Jintropin HGH 10...
China
Main Item As a special manufacturer and exporter in
Business Type Manufacturer, Exporter, Wholesaler/Retailer