Recombinant Human Epidermal Growth Factor (rh-EGF)
$40.00 - $120.00
1
Box
(MOQ)
Recombinant Human Epidermal Growth Factor (rh-EGF) EGF is an acidic, 6,200 Dalton peptide (53 amino acids) with 6 conserved cysteine motifs that form three intramolecular disulfide bonds. EGF is one of the most stable proteins, with great tolerance...
China
3YRS
Main Item
testosterone, trenbolone, nandrolone, boldenone, steroid powder, anavar, hgh, Human Growth Hormone, HCG, Human Chorionic Gonadotropin, anavar, anadrol
Business Type
Manufacturer, Exporter, Agent, Distributor, Wholesaler/Retailer, Service
Recombinant human epidermal growth factor (rhEGF) /Human Oligopeptide-1
1
Unit
(MOQ)
Recombinant human epidermal growth factor (rhEGF) 1.Basic information: INCI Name: Recombinant human epidermal growth factor (rhEGF) Reference: Human Oligopeptide-1 Cas No: 62253-63-8 Formula: Molecular: Grade: cosmetic Source: synthetic Odor: no...
China
2YRS
Main Item
Gs441524, Kojic Acid , DHHB, Arbutin , 3-O-Ethyl Ascorbic acid, L-Ascorbic acid 2-glucoside
Business Type
Manufacturer, Exporter
Recombinant human epidermal growth factor
1
Unit
(MOQ)
Recombinant human epidermal growth factor CAS: 62253-63-8 -Product Introduction Recombinant human epidermal growth factor (EGF) is a bioactive protein factor used for cell culture. EGF has a profound influence on the differentiation of specific...
China
Main Item
hyaluronidase, Recombinant Carboxypeptidase B, Recombinant Trypsin
Business Type
Manufacturer
Cosmetic Peptides Skin EGF Serum Essence Freeze-Dried Powder
1
Unit
(MOQ)
Cosmetic Peptides skin egf serum essence freeze-dried powder Products Description: Product Name Recombinant human egf powder Main Ingredient Recombinant human epidermal growth factor,mannitol,trehalose Function Epidermal repair, whitening and...
Hong Kong
5YRS
Main Item
Beauty & Health Products
Business Type
Manufacturer, Exporter, Wholesaler/Retailer
EGF(recombinant human epidermal growth factor)
$5.00
1
Unit
(MOQ)
[Name] EGF(recombinant human epidermal growth factor) [Specification]two bottles, one is 60mg powder, another is water. [Function] EGF stimulates cells in the skin called fibroblasts, which produce collagen and elastin to clarify, thicken and...
China
Main Item
Cosmetics
Business Type
Manufacturer, Exporter, Importer
Recombinant human epidermal growth factor (rhEGF) /Human Oligopeptide-1
Recombinant human epidermal growth factor (rhEGF) 1.Basic information: INCI Name: Recombinant human epidermal growth factor (rhEGF) Reference: Human Oligopeptide-1 Cas No: 62253-63-8 Formula: Molecular: Grade: cosmetic Source: synthetic Odor: no...
China
Main Item
Cosmetic peptides, peptides, beauty raw materials, custom peptides, pharmaceutical intermediates
Business Type
Manufacturer
Recombinant Human EGF
$1,560.00
1
Milligram
(MOQ)
Recombinant Human EGF Catalog Number: TL-613 Gene Name Synonym: Epidermal Growth Factor, HOMG4, URG Construction: A DNA sequence encoding the extracellular domain of human EGF (NP_001954.2) was expressed with the C-terminal fused Fc region of human...
China
Main Item
Recombinant proteins, cell sorting reagents, serum-free medium, cell culture kits, tool enzymes, IVD protein raw materials
Business Type
Manufacturer
Epidermal growth factor(EGF)
Epidermal growth factor rhEGF Source: Escherichia Coli. Synonyms: Epidermal growth factor,Urogastrone, recombinant human EGF (rhEGF), CAS NO.: 62253-63-8 Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR Modifications:...
China
Main Item
Cosmeceutical serums, cosmetic peptides, Antioxidants,
Business Type
Exporter, Service
Recombinant Human Epidermal Growth Factor
EGF (Recombinant Human Epidermal Growth Factor) Recombinant human epidermal growth factor (rhEGF), one of human growth factors, is a 6.2 KDa protein containing 53 amino acid residues. EGF is a highly efficient cell division factor with many other...
China
Main Item
EGF
Business Type
Manufacturer, Exporter
Anti-human Pro-epidermal growth factor polyclonal antibody
Code: CSB-PA06244A0Rb Description: Rabbit anti-human Pro-epidermal growth factor polyclonal Antibody http://www.flarebio.com/product_b_449201.html Species reactivity: Human Conjugate: Non-conjugated Tested applications: WB,ELISA.Not yet tested in...
Recombinant human epidermal growth factor,rh-EGF,rhEGF,EGF
Source: E. coli Purity:> 95% / 98% Usage / Used as : 1 Reagent for 98% EGF 2 95% GMP grade,pharmaceutical / cosmetic raw material
China
Main Item
Zinc metallothionein egf kgf-2 bfgf
Business Type
Manufacturer, Exporter
Recombinant Human Epidermal Growth Factor, EGF
Use for Skin-Cosmetics, which can reducing and preventing lines and wrinkles on skin, and use for eliminate scars on skin and heals the wounded cuticle by promoting the growth of epidermis and forming new skin cells.
China
Main Item
Acetyl Hexapeptide-3(Argireline), Palmitoyl Pentapeptide(Matrixyl Acetate; Pal-KTTKS), Epidermal Growth Factor (EGF), Glabridin, Dipotassium Glycyrrhizinate, Kojic Dipalmitate, Coenzyme Q10
Business Type
Manufacturer, Exporter
EGF human epidermal growth factor
Recombinant human epidermal growth factor (rhEGF), one of human growth factors, is a 6.2 KDa protein containing 53 amino acid residues. EGF is a highly efficient cell division factor with many other biological effects, which mainly includes: 1....
China
Main Item
EGF, KOJIC ACID, ARBUTIN
Business Type
Manufacturer, Exporter
Recombinant Human Epidermal Growth Factor
INCI Name : rh-Oligopeptide-1 CAS No. : 62253-63-8 Trade Name : MC-EGF Skin care Rejuvenate skin by stimulating cell proliferation Improves the texture and condition of the skin Hair care Stimulate blood circulation of scalp, improve scalp’s...
China
Main Item
erythrulose, kojic dipalmitate, EGF, alpha arbutin, 3-Hydroxypyridine
Business Type
Manufacturer
China
Main Item
mefenamic acid
Business Type
Manufacturer, Exporter
EGF(epidermal growth factor)
Recombinant human epidermal growth factor (rhEGF), one of human growth factors, is a 6.2 KDa protein containing 53 amino acid residues. EGF is a highly efficient cell division factor with many other biological effects, which mainly includes: 1....
China
Main Item
ACID
Business Type
Manufacturer, Exporter
EGF(Epidermal Growth Factor)
Introduction Epidermal Growth Factor (EGF) is most widely used growth factor in cosmetics and cosmeceuticals. This growth factor plays an important role in the regulation of cell growth, proliferation and differentiation in human skin. BIO-FD&C EGF...
Korea
Main Item
aFGF(acidic Fibroblast Growth Factor)
Business Type
Manufacturer, Exporter
Epidermal growth factor(EGF)
CAS No.: 62253-63-8 INCI Name: Human Oligopeptide-1 Source: E. coli Endotoxin level: less than 0.1 ng per μg (1EU/ug) of EGF. Recombinant human epidermal growth factor (rhEGF), one of human growth factors, is a 6.2 KDa protein containing 53 amino...
China
Main Item
Heterocyclic Compounds With Oxygen Hetero-atom Only
Business Type
Manufacturer, Exporter
Hertraz Trastuzumab 440 Mg Injection, Mylan
$533.00 - $535.00
10
Units
(MOQ)
Hertraz 440mg Injection is a recombinant IgG1 monoclonal antibody. It works against the HER2 (human epidermal growth factor receptor protein) receptors which are responsible for the over-proliferation of cancer cells in breast cancer and stomach...
India
Main Item
Medicine
Business Type
Exporter, Distributor, Wholesaler/Retailer
Human EGFR/ErbB1 (Epidermal Growth Factor Receptor) ELISA Kit
Human EGFR/ErbB1 (Epidermal Growth Factor Receptor) ELISA Kit Catalog No:E-EL-H0060 Elabscience Biotechnology Co., Ltd. Price: 495USD Package: 96T/kit Intended use This ELISA kit applies to the in vitro quantitative determination of Human...
China
Main Item
ELISA kits
Business Type
Manufacturer, Exporter