Menu
Recombinant Human Epidermal Growth Factor (rh-EGF)

Recombinant Human Epidermal Growth Factor (rh-EGF)

Recombinant Human Epidermal Growth Factor (rh-EGF) EGF is an acidic, 6,200 Dalton peptide (53 amino acids) with 6 conserved cysteine motifs that form three intramolecular disulfide bonds. EGF is one of the most stable proteins, with great tolerance...
China
3YRS
YES Gold
Main Item testosterone, trenbolone, nandrolone, boldenone, steroid powder, anavar, hgh, Human Growth Hormone, HCG, Human Chorionic Gonadotropin, anavar, anadrol
Business Type Manufacturer, Exporter, Agent, Distributor, Wholesaler/Retailer, Service
Recombinant human epidermal growth factor (rhEGF) /Human Oligopeptide-1

Recombinant human epidermal growth factor (rhEGF) /Human Oligopeptide-1

Recombinant human epidermal growth factor (rhEGF) 1.Basic information: INCI Name: Recombinant human epidermal growth factor (rhEGF) Reference: Human Oligopeptide-1 Cas No: 62253-63-8 Formula: Molecular: Grade: cosmetic Source: synthetic Odor: no...
China
2YRS
YES Gold
Main Item Gs441524, Kojic Acid , DHHB, Arbutin , 3-O-Ethyl Ascorbic acid, L-Ascorbic acid 2-glucoside
Business Type Manufacturer, Exporter
Recombinant human epidermal growth factor

Recombinant human epidermal growth factor

Recombinant human epidermal growth factor CAS: 62253-63-8 -Product Introduction Recombinant human epidermal growth factor (EGF) is a bioactive protein factor used for cell culture. EGF has a profound influence on the differentiation of specific...
China
Main Item hyaluronidase, Recombinant Carboxypeptidase B, Recombinant Trypsin
Business Type Manufacturer
Cosmetic Peptides Skin EGF Serum Essence Freeze-Dried Powder

Cosmetic Peptides Skin EGF Serum Essence Freeze-Dried Powder

Cosmetic Peptides skin egf serum essence freeze-dried powder Products Description: Product Name Recombinant human egf powder Main Ingredient Recombinant human epidermal growth factor,mannitol,trehalose Function Epidermal repair, whitening and...
Hong Kong
5YRS
YES Gold
Main Item Beauty & Health Products
Business Type Manufacturer, Exporter, Wholesaler/Retailer
EGF(recombinant human epidermal growth factor)

EGF(recombinant human epidermal growth factor)

[Name] EGF(recombinant human epidermal growth factor) [Specification]two bottles, one is 60mg powder, another is water. [Function] EGF stimulates cells in the skin called fibroblasts, which produce collagen and elastin to clarify, thicken and...
China
Main Item Cosmetics
Business Type Manufacturer, Exporter, Importer
Epidermal Growth Factor(Tipek)/swine feed additives/Animal health Products
1/2

Epidermal Growth Factor(Tipek)/swine feed additives/Animal health Products

Under the modern intensive production systems, early weaning of suckling piglets is usually carried out before 25 days of age, at the early stage of weaning, the intestinal enterocyte were severely damaged and the villus height was greatly reduced....
China
Main Item Antimicrobial Peptides
Business Type Manufacturer, Exporter, Distributor
Pharmaceutical Grade Osimertinib Mesylate API CAS 1421373-66-1

Pharmaceutical Grade Osimertinib Mesylate API CAS 1421373-66-1

Osimertinib Mesylate is the mesylate salt form of osimertinib, a third-generation, orally available, irreversible, mutant-selective, epidermal growth factor receptor (EGFR) inhibitor, with potential antineoplastic activity. Upon oral...
China
Main Item API
Business Type Manufacturer
DBH Dermaesthetics EGF FGF UV Shield SPF 47 PA+++ Sunscreen - Made in USA

DBH Dermaesthetics EGF FGF UV Shield SPF 47 PA+++ Sunscreen - Made in USA

DBH Dermaestics EGF FGF UV Shield SPF 47 PA+++ Sunscreen - Made in USA Description: The EGF FGF UV Shield is a luxurious moisturizing sunblock with SPF 47+ broad-spectrum/PA+++ rating protection, without any of the greasy feel. Formulated with...
United Kingdom
1YR
YES Siver
Main Item cosmetics & electronics
Business Type Exporter, Importer, Agent, Distributor, Wholesaler/Retailer
Recombinant human epidermal growth factor (rhEGF) /Human Oligopeptide-1

Recombinant human epidermal growth factor (rhEGF) /Human Oligopeptide-1

Recombinant human epidermal growth factor (rhEGF) 1.Basic information: INCI Name: Recombinant human epidermal growth factor (rhEGF) Reference: Human Oligopeptide-1 Cas No: 62253-63-8 Formula: Molecular: Grade: cosmetic Source: synthetic Odor: no...
China
Main Item Cosmetic peptides, peptides, beauty raw materials, custom peptides, pharmaceutical intermediates
Business Type Manufacturer
CAS#183319-69-9

CAS#183319-69-9

Catalog No.:ALS10038 Aolisenchem provides API of Erlotinib hydrochloride CAS#183319 69 9. This kind of pharmaceutical ingredients ingredients can be used as selective epidermal growth factor receptor(EGFR)-tyrosine kinase inhibitor. Antineoplastic....
China
Main Item API
Business Type Manufacturer
Recombinant Human EGF

Recombinant Human EGF

Recombinant Human EGF Catalog Number: TL-613 Gene Name Synonym: Epidermal Growth Factor, HOMG4, URG Construction: A DNA sequence encoding the extracellular domain of human EGF (NP_001954.2) was expressed with the C-terminal fused Fc region of human...
China
Main Item Recombinant proteins, cell sorting reagents, serum-free medium, cell culture kits, tool enzymes, IVD protein raw materials
Business Type Manufacturer
Epidermal growth factor(EGF)

Epidermal growth factor(EGF)

Epidermal growth factor rhEGF Source: Escherichia Coli. Synonyms: Epidermal growth factor,Urogastrone, recombinant human EGF (rhEGF), CAS NO.: 62253-63-8 Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR Modifications:...
China
Main Item Cosmeceutical serums, cosmetic peptides, Antioxidants,
Business Type Exporter, Service
Epidermal Growth Factor

Epidermal Growth Factor

Epidermal growth factor (EGF) is a growth factor that stimulates cell growth, proliferation, and differentiation by binding to its receptor EGFR. Human EGF is a 6045-Da protein with 53 amino acid residues and three intramolecular disulfide bonds....
Korea
Main Item Epidermal Growth Factor, skin care, beauty
Business Type Manufacturer
Epidermal Growth Factor/EGF
China
Main Item oxytocin/carbetocin/terlipressin/bivalirudin/
Business Type Manufacturer, Exporter, Wholesaler/Retailer, Service
Anti-human Pro-epidermal growth factor polyclonal antibody

Anti-human Pro-epidermal growth factor polyclonal antibody

Code: CSB-PA06244A0Rb Description: Rabbit anti-human Pro-epidermal growth factor polyclonal Antibody http://www.flarebio.com/product_b_449201.html Species reactivity: Human Conjugate: Non-conjugated Tested applications: WB,ELISA.Not yet tested in...
China
Main Item antibody
Business Type Manufacturer, Exporter
Hertraz Trastuzumab 440 Mg Injection, Mylan

Hertraz Trastuzumab 440 Mg Injection, Mylan

Hertraz 440mg Injection is a recombinant IgG1 monoclonal antibody. It works against the HER2 (human epidermal growth factor receptor protein) receptors which are responsible for the over-proliferation of cancer cells in breast cancer and stomach...
India
Main Item Medicine
Business Type Exporter, Distributor, Wholesaler/Retailer
Best Epidermal Growth Factor EGF Serum

Best Epidermal Growth Factor EGF Serum

Product Name: BFGF Serum Effective Ingredients: BFGF, EGF, Apple Stem Cell, Hyaluronic Acid, Licorice Extract, Algae Extract, Glycerin, Portulaca Oleracea Extract, Amino Acid, Oat Beta Glucan, Vitamin B5, Ceramides Efficacy: Repair + Promoste Cell...
Netherlands
Main Item redbull, hieneken beer, Frozen Pork, sisal fiber, wood pellets, CHICKEN FEETS, FROZEN FOOD, MILK POWDER, copy papers
Business Type Manufacturer, Exporter, Distributor, Wholesaler/Retailer
Erlotinib hydrochloride

Erlotinib hydrochloride

Erlotinib hydrochloride is a reversible inhibitor of epidermal growth factor receptor tyrosine kinase, which is mainly used in the second or third line treatment of locally advanced or metastatic non-small cell lung cancer and pancreatic cancer
China
Main Item Promestriene;Megestrol Acetate ;Eperisone Hydrochloride;Calcium polystyrene sulfonate
Business Type Manufacturer
Epidermal Growth Factor (EGF)

Epidermal Growth Factor (EGF)

Recombinant human epidermal growth factor (rhEGF), one of human growth factors, is a 6.2 KDa protein containing 53 amino acid residues. EGF is a highly efficient cell division factor with many other biological effects. Alternate names: EGF, rhEGF,...
China
Main Item EGF
Business Type Manufacturer, Exporter
EGF(Epidermal Growth Factor)

EGF(Epidermal Growth Factor)

Introduction Epidermal Growth Factor (EGF) is most widely used growth factor in cosmetics and cosmeceuticals. This growth factor plays an important role in the regulation of cell growth, proliferation and differentiation in human skin. BIO-FD&C EGF...
Korea
Main Item aFGF(acidic Fibroblast Growth Factor)
Business Type Manufacturer, Exporter