Products

See All

Fresh/ Frozen Salmon Fish Top Quality

Our company sells or distribute many varieties of Frozen Fresh Fish in Whole and Fillets. We have available, Frozen Mackerel Fish, Frozen Horse Mackerel Fish, Frozen Hake Fish, Frozen Red Seabream Fish, Frozen King Salmon Fish, Frozen Tuna Fish, ...
United Kingdom
YES Gold YES Gold Member

Fresh and Frozen Salmon Fish Top Quality

We are sellers of Frozen Salmon Fish and we are looking for serious buyers to establish good and long term business with We sell at affordable prices We sell Both FOB and CIF. contact us for more details
Poland
YES Silver YES Silver Member

Fresh and Frozen Atlantic Salmon Fish

12kg bulk/carton or as customer's requirements 1x20FCL=8-10MT (10% more or less) 1x40FCL=18MT-22MT (10%more or less)
Category: Agriculture | Fish
Hungary
YES Silver YES Silver Member

FRESH ATLANTIC SALMON

FRESH ATLANTIC SALMON Origin: ICELAND/NORWAY Size: 2-3 / 3-4 / 4-5/ 5-6 / 6-7 / 7-8 / 8-9 / 9+ Packing: 20 kg. airboxes / 500 kg. each pallet PAYMENT: T/T Also available fillets: A trim / B trim / C trim / D trim / E trim Fillets can be IVP packed ...

Seafood salmon dice fish flavor cat food

1.Product name:Seafood salmon dice fish flavor cat food 2.Material:100% salmon 3.Packaing:as customer need 4.Shelf life:24 monthes 5.Moq:100kg--Made from 100% natural and fresh salmon --without any chemical additives --Rich in high-quality protein and ...

Raw materials peptides Calcitonin salmon

Raw materials peptides Calcitonin salmon Product name:Calcitonin salmon Other name:CALCITONIN, SALMON;CALCITONIN (SALMON I);CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);(DISULFIDE BRIDGE: 1-7) ...

Norwegian Salmon notebook

function googleTranslateElementInit() { new google.translate.TranslateElement({pageLanguage: 'en'}, 'google_translate_element'); } window.___gcfg = {lang: 'en-GB'}; (function() { var po = document.createElement('script'); po.type = 'text/javascript'; ...

Mosbeau Placenta White Advanced Supplement

Get better and advanced skin whitening with Mosbeau Placenta White Advanced Supplement. 100% made in Japan, it is tried and trusted by millions of women worldwide. It contains Horse Placental Protein, a famous whitening and anti-aging ingredient in ...

Chicken Strip with Salmon Organic Dog Food

1.Moisture: Max 23% 2.Shelf Life: 18 Months 3.Material: Fresh Fish Meat and Chicken Breast 4.Certificate: HACCP,FDA,APPA,ISO GMP,SGS,BRC,FSSC,IFS 5.Packaging: Printed Polybags 6.Company style: Manufacturer ,OEM service 7.Advantage: Factory price ...

Dill extract

Keywords:Dill extract,Dill,Anethum graveolens,Dill weed,cumin,Herbal Extract Product name:Dill extract CAS: 90028-03-8 Description:Dill (Anethum graveolens), is either a perennial or annual herb. It is the sole species of the genus Anethum. Fresh and ...
Hong Kong
YES Gold YES Gold Member

Selling Leads

See All

Fresh/ Frozen Salmon Fish Top Quality

Our company sells or distribute many varieties of Frozen Fresh Fish in Whole and Fillets. We have available, Frozen Mackerel Fish, Frozen Horse Mackerel Fish, Frozen Hake Fish, Frozen Red Seabream Fish, Frozen King Salmon Fish, Frozen Tuna Fish, .....
United Kingdom
Date: Aug 19, 2016
United Kingdom
YES Gold YES Gold Member
Fresh and Frozen Salmon Fish Top Quality

Fresh and Frozen Salmon Fish Top Quality

We are sellers of Frozen Salmon Fish and we are looking for serious buyers to establish good and long term business with We sell at affordable prices We sell Both FOB and CIF. contact us for more details
Date: Sep 22, 2016
Poland
YES Silver YES Silver Member
SALMON (Fresh or Frozen)

SALMON (Fresh or Frozen)

Sell Salmon from Chile: Product: Atlantic Salmon (Salmo Salar) Presentation: Head on Gutted (H/ON), Head off Gutted (HG), fillet Format: Fresh or Frozen Origin: Chile Quality: Premium Color: 14+ Size: 4-5 kg, 5-6 kg, 6 kg- up If your company have .....
Date: Nov 03, 2011
Category: Food & Beverage | Fish
Pollock Fish,Salmon Fish,Shrimp,Sole Fish,Squid, Tilapia Fish ,Tuna,Whiting Fish,Markerel Fish

Pollock Fish,Salmon Fish,Shrimp,Sole Fish,Squid, Tilapia Fish ,Tuna,Whiting Fish,Markerel Fish

Universal trading.co.ltd, is a sourcing company of frozen fish and seafoods, such as tilapia (tilapia Fillet, tilapia gutted & scaled), yellow croaker, golden pompano, pacific mackerel, horse mackerel, sardines, bonito, black pomfret, red pomfret, .....
Date: Aug 11, 2016
Category: Agriculture | Fish
Fish Trout, Salmon, Fresh or Frozen

Fish Trout, Salmon, Fresh or Frozen

Our facilities are established in the Lake Bahcelik Dam, 70 km East of Kayseri City in Turkey. We produce "rainbow trout" and "salmon" with the capacity of 950 tons/year, with 45 cages (each cage has the diameter of 20 meters). Mercan Seafood has.....
MERCAN SEAFOOD - FLOATING CAGE FACILITIES
Turkey
Date: Nov 12, 2009
MERCAN SEAFOOD - FLOATING CAGE FACILITIES
Turkey

Companies

See All

Mulligan's Co;ltd

This is Mulligan Beijing trading company, Please answer the following questions :We need two kinds
Business Type: Importer, Agent
Category: Food & Beverage | Fish

SAS Chile

SAS CHILE is an agent dedicated to find right product from Chile to be exported to South Korea or any countries in Far East. Value added is the quality audit we performed to assure client that product he bought will be product they will receive
Business Type: Agent

Seafresh

broker selling fresh fish from latin america salmon oyster etc
Business Type: Exporter
Category: Food & Beverage | Fish
Argentina

Affordable Caviar

Affordable Caviar - caviar supllier offers fresh salmon roe caviar, american caviar, black caviar, sturgeon caviar, royal caviar, sushi, ikura, salted salmon roe, massago, tobikko, caviar samplers, wholesale caviar prices buy.
Business Type: Exporter, Importer, Agent, Distributor, Wholesaler/Retailer, Service, Others
United States

Rongcheng Jiamei Seafood Co., Ltd.

Rongcheng Jiamei Seafood Co.Ltd is a subsidiary company of Chishan Group in China which is a large marine products processing enterprise owing to the investment of the Group. Mainly be engaged in frozen fish, squid range and other seafood products ...
Business Type: Manufacturer, Exporter, Distributor

Buying Leads

See All

Salmon Fresh Chilled

Dear Sirs, I am a New Zealand Exporter, of many years experience, and I have limited quantities of live eel and fresh chilled salmon, availiable for export, from New Zealand. Please contact me with your requirements.
Allsorts
New Zealand
Allsorts
New Zealand

FRESH SALMON

WE RE LOOKING FOR WHOLE SALMON ALL SIZES NEED CNF PRICES AND FOB
United Kingdom

live and fresh seafood

We need a range of live crabs ,live mud eel (swamp eel) and fresh grouper,Tuna,Salmon cuttlefish,silver pomfret and black tiger shrimp. Please contact us freely if you are interested. Thanks
Chen Seafood
China
Category: Agriculture | Fish
Chen Seafood
China

SMALL FISHING TACKLE RETAILER

BUYING FISHING TACKLE, LURES, RODS AND FISHING ACCESORIES FOR NORTH AMERICAN RESALE. SPECIALIZING IN FRESH WATER BASS, TROUT AND SALMON.
SMALLMOUTH SPECIALTIES
United States
SMALLMOUTH SPECIALTIES
United States